PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P13200_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 351aa    MW: 38899.5 Da    PI: 6.4406
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P13200_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-092773112155
                            HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            k +yps++e+  LA+++gL+++q+ +WF N+R ++
  GSMUA_Achr2P13200_001 277 KWPYPSETEKVALAESTGLDQKQINNWFINQRKRH 311
                            669*****************************885 PP

2ELK37.84e-13231252122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELKh+Ll+KYsgyL+sL+qE+s
  GSMUA_Achr2P13200_001 231 ELKHHLLKKYSGYLSSLRQELS 252
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.6E-2089133IPR005540KNOX1
PfamPF037902.4E-2191132IPR005540KNOX1
SMARTSM012563.4E-25137188IPR005541KNOX2
PfamPF037916.3E-23141187IPR005541KNOX2
SMARTSM011882.8E-7231252IPR005539ELK domain
PROSITE profilePS5121311.523231251IPR005539ELK domain
PfamPF037893.5E-10231252IPR005539ELK domain
PROSITE profilePS5007112.811251314IPR001356Homeobox domain
SuperFamilySSF466899.84E-20252327IPR009057Homeodomain-like
SMARTSM003898.1E-13253318IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-27256316IPR009057Homeodomain-like
CDDcd000861.37E-12263315No hitNo description
PfamPF059201.3E-16271310IPR008422Homeobox KN domain
PROSITE patternPS000270289312IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MEEFSHLGGG STSRGANFLY LPSSTTTTTS AAAQLNAAAY GRSCHPTLPY LQPPVPLKPE  60
VGSALQPSSS QEGAVDGRGQ GEISPGDTEE IKAKIMSHPQ YSTLIGAYID CQTVGAPPDV  120
VARLSAIARE LQSRSRCRQE ASSDPELDQF MEAYCGLLVK YREELTRPLH EATDFLRRVE  180
SQFNALTNTP SSRIFYSDEG CEGVASSEEE ADASGGETDV SLIDPHADDK ELKHHLLKKY  240
SGYLSSLRQE LSKKKKKGKL PKEARQKLLS WWALHYKWPY PSETEKVALA ESTGLDQKQI  300
NNWFINQRKR HWKPSEDMHL VVMDGFHPQN AAASLYMEGQ YMGNGVYRTG P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2260461e-167AC226046.1 Musa acuminata clone BAC MA4-72F16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009388945.10.0PREDICTED: homeobox protein knotted-1-like 2
SwissprotO041351e-131KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLM0S7L10.0M0S7L1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P13200_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-93KNOTTED-like from Arabidopsis thaliana